PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10010595m
Common NameCICLE_v10010595mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family Trihelix
Protein Properties Length: 509aa    MW: 58168.3 Da    PI: 7.3605
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10010595mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix101.94.8e-32391475186
         trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                      rW+k ev aLi++r  +e+r+ +  lk+plWeevs+ m++ g++rs+k+Ckekwen+nk+++k+ke+ kkr s++s+tcpyfdql+
  Ciclev10010595m 391 RWPKTEVEALIQVRGGLESRFLEPGLKGPLWEEVSALMASMGYQRSAKRCKEKWENINKYFRKTKESGKKR-SPQSKTCPYFDQLD 475
                      8*********************************************************************8.67778********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.957384448IPR017877Myb-like domain
PfamPF138371.5E-22390477No hitNo description
CDDcd122036.71E-28390455No hitNo description
Sequence ? help Back to Top
Protein Sequence    Length: 509 aa     Download sequence    Send to blast
MQSGYGASEI HQHHQNLIGD ADDDVDGCCP SIFTISNPPE NNHLYHRHPR QHLQQEKHPQ  60
QQQQMFQPPP PPPSPFTHRL LRPFQTLIHQ PQQQQQQGER LHSQLGLEVQ DPCPTSLHPF  120
FDVNFKLGLN ENSGNDGSKH EITTLLHGNE QQQHHNHQSL VMPPHSWHSQ EDSSAIKLQE  180
PFWKPGVVDK DQPENIKKHH VMGSKYQHFG GELEAIYGLA NAKINVETDN QITGSGSAII  240
GVNDLDHGSE NSIGEEKLAH EKKNRKRKMK EKLSSMFGFF EGLVKQVIDH QEGLHRKFVE  300
VVQRMDREKS EREEAWRRED AAKYNREAIA RAHEQAAALS REALIISHLE KITGQSINLP  360
PRKTALLLVQ PDQVITKGPT KEWKSDMISR RWPKTEVEAL IQVRGGLESR FLEPGLKGPL  420
WEEVSALMAS MGYQRSAKRC KEKWENINKY FRKTKESGKK RSPQSKTCPY FDQLDQLYSR  480
NNPINIPSDP DMGVQNQGYS ELLEAFAAA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1261268KKNRKRKM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00651PBMTransfer from LOC_Os02g01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB5731490.0AB573149.1 Citrus unshiu genomic DNA, polyembryony locus, cultivar: Miyagawa wase.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006453007.10.0hypothetical protein CICLE_v10010595mg, partial
TrEMBLV4UJD10.0V4UJD1_9R
STRINGPOPTR_0018s05520.11e-110(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM16469813
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G76890.24e-41Trihelix family protein